DBT Blocking Peptide (33R-6946)

A synthetic peptide for use as a blocking control in assays to test for specificity of DBT antibody, catalog no. 70R-2499

Synonyms DBT control peptide, DBT antibody Blocking Peptide, Anti-DBT Blocking Peptide, Dihydrolipoamide Branched Chain Transacylase E2 Blocking Peptide, BCATE2 Blocking Peptide, E2 Blocking Peptide, E2B Blocking Peptide, MGC9061 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues NYVCFFGYPSFKYSHPHHFLKTTAALRGQVVQFKLSDIGEGIREVTVKEW
Molecular Weight 46 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The branched-chain alpha-keto dehydrogenase complex catalyzes the overall conversion of alpha-keto acids to acyl-CoA and CO2. It contains multiple copies of three enzymatic components: branched-chain alpha-keto acid decarboxylase (E1), lipoamide acyltransferase (E2) and lipoamide dehydrogenase (E3).

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors