DBT Blocking Peptide (33R-6946)
A synthetic peptide for use as a blocking control in assays to test for specificity of DBT antibody, catalog no. 70R-2499
Overview
Overview
| Synonyms | DBT control peptide, DBT antibody Blocking Peptide, Anti-DBT Blocking Peptide, Dihydrolipoamide Branched Chain Transacylase E2 Blocking Peptide, BCATE2 Blocking Peptide, E2 Blocking Peptide, E2B Blocking Peptide, MGC9061 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | NYVCFFGYPSFKYSHPHHFLKTTAALRGQVVQFKLSDIGEGIREVTVKEW |
|---|---|
| Molecular Weight | 46 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | The branched-chain alpha-keto dehydrogenase complex catalyzes the overall conversion of alpha-keto acids to acyl-CoA and CO2. It contains multiple copies of three enzymatic components: branched-chain alpha-keto acid decarboxylase (E1), lipoamide acyltransferase (E2) and lipoamide dehydrogenase (E3). |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product