DCK antibody (70R-3128)

Rabbit polyclonal DCK antibody raised against the middle region of DCK

Synonyms Polyclonal DCK antibody, Anti-DCK antibody, MGC138632 antibody, Deoxycytidine Kinase antibody, MGC117410 antibody
Specificity DCK antibody was raised against the middle region of DCK
Cross Reactivity Human,Mouse
Applications WB
Immunogen DCK antibody was raised using the middle region of DCK corresponding to a region with amino acids QLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQD
Assay Information DCK Blocking Peptide, catalog no. 33R-7620, is also available for use as a blocking control in assays to test for specificity of this DCK antibody


Western Blot analysis using DCK antibody (70R-3128)

DCK antibody (70R-3128) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 30 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DCK antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Deoxycytidine kinase (DCK) is required for the phosphorylation of several deoxyribonucleosides and their nucleoside analogs. Deficiency of DCK is associated with resistance to antiviral and anticancer chemotherapeutic agents. Conversely, increased deoxycytidine kinase activity is associated with increased activation of these compounds to cytotoxic nucleoside triphosphate derivatives. DCK is clinically important because of its relationship to drug resistance and sensitivity.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using DCK antibody (70R-3128) | DCK antibody (70R-3128) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors