DCST1 antibody (70R-6684)

Rabbit polyclonal DCST1 antibody raised against the C terminal of DCST1

Synonyms Polyclonal DCST1 antibody, Anti-DCST1 antibody, DCST-1 antibody, DCST-1, Dc-Stamp Domain Containing 1 antibody, RP11-307C12.10 antibody, DCST 1, DCST1, DCST 1 antibody, FLJ32785 antibody
Specificity DCST1 antibody was raised against the C terminal of DCST1
Cross Reactivity Human
Applications WB
Immunogen DCST1 antibody was raised using the C terminal of DCST1 corresponding to a region with amino acids SYVCRTLDCEAVYCWSCWDDMRQRCPVCTPREELSSSAFSDSNDDTAYAG
Assay Information DCST1 Blocking Peptide, catalog no. 33R-8960, is also available for use as a blocking control in assays to test for specificity of this DCST1 antibody

Images

Western Blot analysis using DCST1 antibody (70R-6684)

DCST1 antibody (70R-6684) used at 0.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 78 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DCST1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of DCST1 protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using DCST1 antibody (70R-6684) | DCST1 antibody (70R-6684) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors