DCTD antibody (70R-4083)

Rabbit polyclonal DCTD antibody raised against the middle region of DCTD

Synonyms Polyclonal DCTD antibody, Anti-DCTD antibody, MGC111062 antibody, Dcmp Deaminase antibody
Specificity DCTD antibody was raised against the middle region of DCTD
Cross Reactivity Human
Applications WB
Immunogen DCTD antibody was raised using the middle region of DCTD corresponding to a region with amino acids MSDKYHDSDEATAARLLFNMAGVTFRKFIPKCSKIVIDFDSINSRPSQKL
Assay Information DCTD Blocking Peptide, catalog no. 33R-6407, is also available for use as a blocking control in assays to test for specificity of this DCTD antibody

Images

Western Blot analysis using DCTD antibody (70R-4083)

DCTD antibody (70R-4083) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 21 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DCTD antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene catalyzes the deamination of dCMP to dUMP, the nucleotide substrate for thymidylate synthase. The encoded protein is allosterically activated by dCTP and inhibited by dTTP, and is found as a homohexamer. This protein uses zinc as a cofactor for its activity. Two transcript variants encoding different isoforms have been found for this gene.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using DCTD antibody (70R-4083) | DCTD antibody (70R-4083) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors