DCUN1D4 antibody (70R-4213)

Rabbit polyclonal DCUN1D4 antibody

Synonyms Polyclonal DCUN1D4 antibody, Anti-DCUN1D4 antibody, DCUN-1, FLJ42355 antibody, KIAA0276 antibody, DCUN1, Dcn1 Defective In Cullin Neddylation 1 Domain Containing 4 antibody, DCUN-1 antibody, DCUN 1 antibody, DCUN 1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen DCUN1D4 antibody was raised using a synthetic peptide corresponding to a region with amino acids YLRSFLNDSTNFKLIYRYAFDFAREKDQRSLDINTAKCMLGLLLGKIWPL
Assay Information DCUN1D4 Blocking Peptide, catalog no. 33R-10181, is also available for use as a blocking control in assays to test for specificity of this DCUN1D4 antibody


Western Blot analysis using DCUN1D4 antibody (70R-4213)

DCUN1D4 antibody (70R-4213) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 34 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DCUN1D4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DCUN1D4 contains 1 DCUN1 domain. The exact function of DCUN1D4 remains unknown.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using DCUN1D4 antibody (70R-4213) | DCUN1D4 antibody (70R-4213) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors