DDIT4L antibody (70R-2699)

Rabbit polyclonal DDIT4L antibody raised against the middle region of DDIT4L

Synonyms Polyclonal DDIT4L antibody, Anti-DDIT4L antibody, DDITL 4 antibody, DDITL 4, Rtp801L antibody, REDD2 antibody, DDITL-4 antibody, DDIT4L, DDITL-4, Dna-Damage-Inducible Transcript 4-Like antibody
Specificity DDIT4L antibody was raised against the middle region of DDIT4L
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen DDIT4L antibody was raised using the middle region of DDIT4L corresponding to a region with amino acids KLGCSKVLVPEKLTQRIAQDVLRLSSTEPCGLRGCVMHVNLEIENVCKKL
Assay Information DDIT4L Blocking Peptide, catalog no. 33R-4509, is also available for use as a blocking control in assays to test for specificity of this DDIT4L antibody

Images

Western Blot analysis using DDIT4L antibody (70R-2699)

DDIT4L antibody (70R-2699) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 22 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DDIT4L antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DDIT4L inhibits cell growth by regulating the FRAP1 pathway upstream of the TSC1-TSC2 complex and downstream of AKT1.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using DDIT4L antibody (70R-2699) | DDIT4L antibody (70R-2699) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €352.82
Size: 50 ug
OR
Shipping
View Our Distributors