DDX17 antibody (70R-1477)

Rabbit polyclonal DDX17 antibody

Synonyms Polyclonal DDX17 antibody, Anti-DDX17 antibody, DDX 17 antibody, DDX-17, Dead antibody, DDX-17 antibody, DDX 17, DDX17, Asp-Glu-Ala-Asp Box Polypeptide 17 antibody
Cross Reactivity Human,Dog
Applications IHC, WB
Immunogen DDX17 antibody was raised using a synthetic peptide corresponding to a region with amino acids TSSANNPNLMYQDECDRRLRGVKDGGRRDSASYRDRSETDRAGYANGSGY
Assay Information DDX17 Blocking Peptide, catalog no. 33R-9297, is also available for use as a blocking control in assays to test for specificity of this DDX17 antibody


Immunohistochemical staining using DDX17 antibody (70R-1477)

DDX17 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 60 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of DDX17 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and splicesosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using DDX17 antibody (70R-1477) | DDX17 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using DDX17 antibody (70R-1477) | DDX17 antibody (70R-1477) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: €227.26
Size: 100 ug
View Our Distributors