DDX17 antibody (70R-5026)

Rabbit polyclonal DDX17 antibody

Synonyms Polyclonal DDX17 antibody, Anti-DDX17 antibody, DDX-17, DDX 17, RH70 antibody, DKFZp761H2016 antibody, P72 antibody, Dead antibody, DDX-17 antibody, DDX17, Asp-Glu-Ala-Asp Box Polypeptide 17 antibody, DDX 17 antibody
Cross Reactivity Human,Mouse
Applications WB
Immunogen DDX17 antibody was raised using a synthetic peptide corresponding to a region with amino acids PKKFGNPGERLRKKKWDLSELPKFEKNFYVEHPEVARLTPYEVDELRRKK
Assay Information DDX17 Blocking Peptide, catalog no. 33R-7171, is also available for use as a blocking control in assays to test for specificity of this DDX17 antibody

Images

Western Blot analysis using DDX17 antibody (70R-5026)

DDX17 antibody (70R-5026) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 80 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DDX17 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and splicesosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The DEAD box protein is an ATPase activated by a variety of RNA species but not by dsDNA. This protein and that encoded by DDX5 gene are more closely related to each other than to any other member of the DEAD box family.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using DDX17 antibody (70R-5026) | DDX17 antibody (70R-5026) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors