DDX25 antibody (70R-4822)

Rabbit polyclonal DDX25 antibody

Synonyms Polyclonal DDX25 antibody, Anti-DDX25 antibody, Asp-Glu-Ala-Asp Box Polypeptide 25 antibody, DDX25, DDX 25, DDX-25 antibody, DDX 25 antibody, Dead antibody, GRTH antibody, DDX-25
Cross Reactivity Human
Applications WB
Immunogen DDX25 antibody was raised using a synthetic peptide corresponding to a region with amino acids ALQTGRVVEQMGKFCVDVQVMYAIRGNRIPRGTDITKQIIIGTPGTVLDW
Assay Information DDX25 Blocking Peptide, catalog no. 33R-1364, is also available for use as a blocking control in assays to test for specificity of this DDX25 antibody

Images

Western Blot analysis using DDX25 antibody (70R-4822)

DDX25 antibody (70R-4822) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 41 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DDX25 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of the DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DDX25 is a member of this family. The protein is a gonadotropin-regulated and developmentally expressed testicular RNA helicase. It may serve to maintain testicular functions related to steroidogenesis and spermatogenesis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using DDX25 antibody (70R-4822) | DDX25 antibody (70R-4822) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors