DDX31 antibody (70R-1386)

Rabbit polyclonal DDX31 antibody

Synonyms Polyclonal DDX31 antibody, Anti-DDX31 antibody, DDX 31 antibody, DDX31, Asp-Glu-Ala-Asp Box Polypeptide 31 antibody, DDX-31 antibody, DDX-31, DDX 31, Dead antibody
Cross Reactivity Human
Applications WB
Immunogen DDX31 antibody was raised using a synthetic peptide corresponding to a region with amino acids QASSEAPPAKRRNETSFLPAKKTSVKETQRTFKGNAQKMFSPKKHSVSTS
Assay Information DDX31 Blocking Peptide, catalog no. 33R-7480, is also available for use as a blocking control in assays to test for specificity of this DDX31 antibody

Western Blot analysis using DDX31 antibody (70R-1386)

DDX31 antibody (70R-1386) used at 2.5 ug/ml to detect target protein.

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 64 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of DDX31 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DDX31 is a member of this family. The function of this member has not been determined. Alternative splicing of this gene generates 2 transcript variants.

Add a Paper

Sorry, but there are no references currently for this product.

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

  • Western Blot analysis using DDX31 antibody (70R-1386) | DDX31 antibody (70R-1386) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
View Our Distributors