DDX39 antibody (70R-1399)

Rabbit polyclonal DDX39 antibody

Synonyms Polyclonal DDX39 antibody, Anti-DDX39 antibody, Dead antibody, DDX-39 antibody, DDX 39 antibody, Asp-Glu-Ala-Asp Box Polypeptide 39 antibody, DDX39, DDX 39, DDX-39
Cross Reactivity Human
Applications WB
Immunogen DDX39 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAEQDVENDLLDYDEEEEPQAPQESTPAPPKKDIKGSYVSIHSSGFRDFL
Assay Information DDX39 Blocking Peptide, catalog no. 33R-5644, is also available for use as a blocking control in assays to test for specificity of this DDX39 antibody


Western Blot analysis using DDX39 antibody (70R-1399)

DDX39 antibody (70R-1399) used at 1.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 47 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of DDX39 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of the DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DDX39 encodes a member of this family. The function of this member has not been determined. Alternative splicing of this gene generates 2 transcript variants encoding different isoforms.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using DDX39 antibody (70R-1399) | DDX39 antibody (70R-1399) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: €227.26
Size: 100 ug
View Our Distributors