DDX41 antibody (70R-1483)

Rabbit polyclonal DDX41 antibody

Synonyms Polyclonal DDX41 antibody, Anti-DDX41 antibody, DDX41, DDX 41, DDX-41 antibody, Asp-Glu-Ala-Asp Box Polypeptide 41 antibody, Dead antibody, DDX-41, DDX 41 antibody
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen DDX41 antibody was raised using a synthetic peptide corresponding to a region with amino acids AIHEYLLLKGVEAVAIHGGKDQEERTKAIEAFREGKKDVLVATDVASKGL
Assay Information DDX41 Blocking Peptide, catalog no. 33R-1267, is also available for use as a blocking control in assays to test for specificity of this DDX41 antibody

Images

Western Blot analysis using DDX41 antibody (70R-1483)

DDX41 antibody (70R-1483) used at 1.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 68 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of DDX41 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of the DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a member of this family. The function of this member has not been determined. Based on studies in Drosophila, the abstrakt gene is widely required during post-transcriptional gene expression.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using DDX41 antibody (70R-1483) | DDX41 antibody (70R-1483) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
OR
Shipping
View Our Distributors