DDX46 antibody (70R-4793)

Rabbit polyclonal DDX46 antibody

Synonyms Polyclonal DDX46 antibody, Anti-DDX46 antibody, KIAA0801 antibody, MGC9936 antibody, Dead antibody, Asp-Glu-Ala-Asp Box Polypeptide 46 antibody, DDX-46 antibody, DDX46, DDX 46 antibody, PRPF5 antibody, DDX-46, DDX 46, FLJ25329 antibody
Cross Reactivity Human
Applications WB
Immunogen DDX46 antibody was raised using a synthetic peptide corresponding to a region with amino acids LAEKINAKLNYVPLEKQEEERQDGGQNESFKRYEEELEINDFPQTARWKV
Assay Information DDX46 Blocking Peptide, catalog no. 33R-4763, is also available for use as a blocking control in assays to test for specificity of this DDX46 antibody


Western Blot analysis using DDX46 antibody (70R-4793)

DDX46 antibody (70R-4793) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 117 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DDX46 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DDX46 is a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DDX46 is a component of the 17S U2 snRNP complex; it plays an important role in pre-mRNA splicing.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using DDX46 antibody (70R-4793) | DDX46 antibody (70R-4793) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors