DDX47 antibody (70R-4790)

Rabbit polyclonal DDX47 antibody

Synonyms Polyclonal DDX47 antibody, Anti-DDX47 antibody, DDX-47, MSTP162 antibody, E4-DBP antibody, DDX 47 antibody, DDX47, FLJ30012 antibody, DDX-47 antibody, HQ0256 antibody, Asp-Glu-Ala-Asp Box Polypeptide 47 antibody, DKFZp564O176 antibody, DDX 47, Dead antibody
Cross Reactivity Human
Applications WB
Immunogen DDX47 antibody was raised using a synthetic peptide corresponding to a region with amino acids AAPEEHDSPTEASQPIVEEEETKTFKDLGVTDVLCEACDQLGWTKPTKIQ
Assay Information DDX47 Blocking Peptide, catalog no. 33R-1040, is also available for use as a blocking control in assays to test for specificity of this DDX47 antibody


Western Blot analysis using DDX47 antibody (70R-4790)

DDX47 antibody (70R-4790) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 50 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DDX47 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DDX47 is a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using DDX47 antibody (70R-4790) | DDX47 antibody (70R-4790) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors