DDX55 Blocking Peptide (33R-7874)

A synthetic peptide for use as a blocking control in assays to test for specificity of DDX55 antibody, catalog no. 70R-4786

Synonyms DDX55 control peptide, DDX55 antibody Blocking Peptide, Anti-DDX55 Blocking Peptide, Dead Blocking Peptide, Asp-Glu-Ala-Asp Box Polypeptide 55 Blocking Peptide, DDX55, DDX-55, DDX 55, DDX-55 Blocking Peptide, DDX 55 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues RELAIQIDEVLSHFTKHFPEFSQILWIGGRNPGEDVERFKQQGGNIIVAT
Molecular Weight 66 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DDX55 is a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. Multiple alternatively spliced transcript variants have been found for this gene, but the biological validity of only one transcript has been confirmed.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors