DEDD2 Blocking Peptide (33R-7309)
A synthetic peptide for use as a blocking control in assays to test for specificity of DEDD2 antibody, catalog no. 70R-9188
Overview
Overview
| Synonyms | DEDD2 control peptide, DEDD2 antibody Blocking Peptide, Anti-DEDD2 Blocking Peptide, death effector domain containing 2 Blocking Peptide, FLAME-3 Blocking Peptide, DEDD2, DEDD-2, DEDD 2, DEDD-2 Blocking Peptide, DEDD 2 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | PQQQSEPARPSSEGKVTCDIRLRVRAEYCEHGPALEQGVASRRPQALARQ |
|---|---|
| Molecular Weight | 36 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | DEDD2 may play a critical role in death receptor-induced apoptosis and may target CASP8 and CASP10 to the nucleus. DEDD2 may regulate degradation of intermediate filaments during apoptosis. DEDD2 may play a role in the general transcription machinery in the nucleus and might be an important regulator of the activity of GTF3C3. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product