DEDD2 Blocking Peptide (33R-7309)

A synthetic peptide for use as a blocking control in assays to test for specificity of DEDD2 antibody, catalog no. 70R-9188

Synonyms DEDD2 control peptide, DEDD2 antibody Blocking Peptide, Anti-DEDD2 Blocking Peptide, death effector domain containing 2 Blocking Peptide, FLAME-3 Blocking Peptide, DEDD2, DEDD-2, DEDD 2, DEDD-2 Blocking Peptide, DEDD 2 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues PQQQSEPARPSSEGKVTCDIRLRVRAEYCEHGPALEQGVASRRPQALARQ
Molecular Weight 36 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DEDD2 may play a critical role in death receptor-induced apoptosis and may target CASP8 and CASP10 to the nucleus. DEDD2 may regulate degradation of intermediate filaments during apoptosis. DEDD2 may play a role in the general transcription machinery in the nucleus and might be an important regulator of the activity of GTF3C3.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors