DENND1A antibody (70R-3137)

Rabbit polyclonal DENND1A antibody raised against the N terminal of DENND1A

Synonyms Polyclonal DENND1A antibody, Anti-DENND1A antibody, Denn/Madd Domain Containing 1A antibody, FAM31A antibody, RP11-230L22.3 antibody, KIAA1608 antibody, FLJ38464 antibody
Specificity DENND1A antibody was raised against the N terminal of DENND1A
Cross Reactivity Human
Applications WB
Immunogen DENND1A antibody was raised using the N terminal of DENND1A corresponding to a region with amino acids PGVSVHLSVHSYFTVPDTRELPSIPENRNLTEYFVAVDVNNMLHLYASML
Assay Information DENND1A Blocking Peptide, catalog no. 33R-7139, is also available for use as a blocking control in assays to test for specificity of this DENND1A antibody


Western Blot analysis using DENND1A antibody (70R-3137)

DENND1A antibody (70R-3137) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 110 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DENND1A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DENND1A may be involved in the clathrin-mediated endocytosis of synaptic vesicles.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using DENND1A antibody (70R-3137) | DENND1A antibody (70R-3137) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors