LOC728331 Blocking Peptide (33R-1033)
A synthetic peptide for use as a blocking control in assays to test for specificity of DFNA5 antibody, catalog no. 70R-1267
Overview
Overview
| Synonyms | DFNA5 control peptide, DFNA5 antibody Blocking Peptide, Anti-DFNA5 Blocking Peptide, Deafness Autosomal Dominant 5 Blocking Peptide, ICERE-1 Blocking Peptide, DFNA5, DFNA-5, DFNA 5, DFNA-5 Blocking Peptide, DFNA 5 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | AALLGTCCKLQIIPTLCHLLRALSDDGVSDLEDPTLTPLKDTERFGIVQR |
|---|---|
| Molecular Weight | 47 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | Hearing impairment is a heterogeneous condition with over 40 loci described. DFNA5 is expressed in fetal cochlea, however, its function is not known. Nonsyndromic hearing impairment is associated with a mutation in its gene. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product