LOC728331 Blocking Peptide (33R-1033)

A synthetic peptide for use as a blocking control in assays to test for specificity of DFNA5 antibody, catalog no. 70R-1267

Synonyms DFNA5 control peptide, DFNA5 antibody Blocking Peptide, Anti-DFNA5 Blocking Peptide, Deafness Autosomal Dominant 5 Blocking Peptide, ICERE-1 Blocking Peptide, DFNA5, DFNA-5, DFNA 5, DFNA-5 Blocking Peptide, DFNA 5 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues AALLGTCCKLQIIPTLCHLLRALSDDGVSDLEDPTLTPLKDTERFGIVQR
Molecular Weight 47 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Hearing impairment is a heterogeneous condition with over 40 loci described. DFNA5 is expressed in fetal cochlea, however, its function is not known. Nonsyndromic hearing impairment is associated with a mutation in its gene.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €113.70
Size: 100 ug
OR
Shipping
View Our Distributors