DGCR6L Blocking Peptide (33R-7701)
A synthetic peptide for use as a blocking control in assays to test for specificity of DGCR6L antibody, catalog no. 70R-10201
Overview
Overview
| Synonyms | DGCR6L control peptide, DGCR6L antibody Blocking Peptide, Anti-DGCR6L Blocking Peptide, DiGeorge syndrome critical region gene 6-like Blocking Peptide, FLJ10666 Blocking Peptide, DGCR6L, DGCRL-6, DGCRL 6, DGCRL-6 Blocking Peptide, DGCRL 6 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | QQRELEAVEHRIREEQRAMDQKIILELDRKVADQQSTLEKAGVAGFYVTT |
|---|---|
| Molecular Weight | 25 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | This gene, the result of a duplication at this locus, is one of two functional genes encoding nearly identical proteins that have similar expression patterns. The product of this gene is a protein that shares homology with the Drosophila gonadal protein, expressed in gonadal tissues and germ cells, and with the human laminin gamma-1 chain that functions in cell attachment and migration. This gene is located in a region of chromosome 22 implicated in the DiGeorge syndrome, one facet of a broader collection of anomalies referred to as the CATCH 22 syndrome. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product