DHRS9 antibody (70R-5476)

Rabbit polyclonal DHRS9 antibody

Synonyms Polyclonal DHRS9 antibody, Anti-DHRS9 antibody, DHRS 9, DHRS-9 antibody, Sdr Family Member 9 antibody, DHRS 9 antibody, RDH15 antibody, DHRS9, RDHL antibody, DHRS-9, Dehydrogenase/Reductase antibody, RETSDR8 antibody, 3alpha-HSD antibody
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen DHRS9 antibody was raised using a synthetic peptide corresponding to a region with amino acids DPVKVIEKKLAIWEQLSPDIKQQYGEGYIEKSLDKLKGNKSYVNMDLSPV
Assay Information DHRS9 Blocking Peptide, catalog no. 33R-2120, is also available for use as a blocking control in assays to test for specificity of this DHRS9 antibody


Western Blot analysis using DHRS9 antibody (70R-5476)

DHRS9 antibody (70R-5476) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 35 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DHRS9 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DHRS9 is a 3-alpha-hydroxysteroid dehydrogenase that converts 3-alpha-tetrahydroprogesterone (allopregnanolone) to dihydroxyprogesterone and 3-alpha-androstanediol to dihydroxyprogesterone.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using DHRS9 antibody (70R-5476) | DHRS9 antibody (70R-5476) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors