DHX37 antibody (70R-4751)

Rabbit polyclonal DHX37 antibody

Synonyms Polyclonal DHX37 antibody, Anti-DHX37 antibody, DHX-37, MGC46245 antibody, DHX 37, FLJ41974 antibody, DHX 37 antibody, Deah antibody, MGC4322 antibody, Asp-Glu-Ala-His Box Polypeptide 37 antibody, MGC2695 antibody, DHX37, KIAA1517 antibody, DDX37 antibody, DHX-37 antibody
Cross Reactivity Human
Applications WB
Immunogen DHX37 antibody was raised using a synthetic peptide corresponding to a region with amino acids PLTKKEKKVLQKILEQKEKKSQRAEMLQKLSEVQASEAEMRLFYTTSKLG
Assay Information DHX37 Blocking Peptide, catalog no. 33R-7211, is also available for use as a blocking control in assays to test for specificity of this DHX37 antibody


Western Blot analysis using DHX37 antibody (70R-4751)

DHX37 antibody (70R-4751) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 129 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DHX37 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DHX37 is a DEAD box protein. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using DHX37 antibody (70R-4751) | DHX37 antibody (70R-4751) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors