DIRC2 Blocking Peptide (33R-1018)

A synthetic peptide for use as a blocking control in assays to test for specificity of DIRC2 antibody, catalog no. 70R-6544

Synonyms DIRC2 control peptide, DIRC2 antibody Blocking Peptide, Anti-DIRC2 Blocking Peptide, Disrupted In Renal Carcinoma 2 Blocking Peptide, FLJ14784 Blocking Peptide, RCC4 Blocking Peptide, DIRC2, DIRC-2, DIRC 2, DIRC-2 Blocking Peptide, DIRC 2 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues AAESSRAHIKDRIEAVLYAEFGVVCLIFSATLAYFPPRPPLPPSVAAASQ
Molecular Weight 52 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DIRC2 is a membrane-bound protein from the major facilitator superfamily of transporters. Disruption of DIRC2 by translocation has been associated with haplo-insufficiency and renal cell carcinomas. Alternatively spliced transcript variants have been described, but their biological validity has not yet been determined.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors