DIRC2 Blocking Peptide (33R-1018)
A synthetic peptide for use as a blocking control in assays to test for specificity of DIRC2 antibody, catalog no. 70R-6544
Overview
Overview
| Synonyms | DIRC2 control peptide, DIRC2 antibody Blocking Peptide, Anti-DIRC2 Blocking Peptide, Disrupted In Renal Carcinoma 2 Blocking Peptide, FLJ14784 Blocking Peptide, RCC4 Blocking Peptide, DIRC2, DIRC-2, DIRC 2, DIRC-2 Blocking Peptide, DIRC 2 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | AAESSRAHIKDRIEAVLYAEFGVVCLIFSATLAYFPPRPPLPPSVAAASQ |
|---|---|
| Molecular Weight | 52 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | DIRC2 is a membrane-bound protein from the major facilitator superfamily of transporters. Disruption of DIRC2 by translocation has been associated with haplo-insufficiency and renal cell carcinomas. Alternatively spliced transcript variants have been described, but their biological validity has not yet been determined. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product