DISC1 antibody (70R-2399)

Rabbit polyclonal DISC1 antibody raised against the N terminal of DISC1

Synonyms Polyclonal DISC1 antibody, Anti-DISC1 antibody, DISC 1 antibody, DISC-1 antibody, Disrupted In Schizophrenia 1 antibody, SCZD9 antibody, KIAA0457 antibody, DISC-1, DISC1, DISC 1
Specificity DISC1 antibody was raised against the N terminal of DISC1
Cross Reactivity Human
Applications WB
Immunogen DISC1 antibody was raised using the N terminal of DISC1 corresponding to a region with amino acids AACFRRRRLARRPGYMRSSTGPGIGFLSPAVGTLFRFPGGVSGEESHHSE
Assay Information DISC1 Blocking Peptide, catalog no. 33R-1012, is also available for use as a blocking control in assays to test for specificity of this DISC1 antibody

Images

Western blot analysis using DISC1 antibody (70R-2399)

Recommended DISC1 Antibody Titration: 0.2-1 ug/ml

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 38 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DISC1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DISC1 is a protein with multiple coiled coil motifs which is located in the nucleus, cytoplasm and mitochondria. The protein is involved in neurite outgrowth and cortical development through its interaction with other proteins.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using DISC1 antibody (70R-2399) | Recommended DISC1 Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors