DISC1 Blocking Peptide (33R-1012)
A synthetic peptide for use as a blocking control in assays to test for specificity of DISC1 antibody, catalog no. 70R-2399
Overview
Overview
| Synonyms | DISC1 control peptide, DISC1 antibody Blocking Peptide, Anti-DISC1 Blocking Peptide, Disrupted In Schizophrenia 1 Blocking Peptide, KIAA0457 Blocking Peptide, SCZD9 Blocking Peptide, DISC1, DISC-1, DISC 1, DISC-1 Blocking Peptide, DISC 1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | AACFRRRRLARRPGYMRSSTGPGIGFLSPAVGTLFRFPGGVSGEESHHSE |
|---|---|
| Molecular Weight | 38 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | DISC1 is a protein with multiple coiled coil motifs which is located in the nucleus, cytoplasm and mitochondria. The protein is involved in neurite outgrowth and cortical development through its interaction with other proteins. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product