DISC1 Blocking Peptide (33R-1012)

A synthetic peptide for use as a blocking control in assays to test for specificity of DISC1 antibody, catalog no. 70R-2399

Synonyms DISC1 control peptide, DISC1 antibody Blocking Peptide, Anti-DISC1 Blocking Peptide, Disrupted In Schizophrenia 1 Blocking Peptide, KIAA0457 Blocking Peptide, SCZD9 Blocking Peptide, DISC1, DISC-1, DISC 1, DISC-1 Blocking Peptide, DISC 1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues AACFRRRRLARRPGYMRSSTGPGIGFLSPAVGTLFRFPGGVSGEESHHSE
Molecular Weight 38 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DISC1 is a protein with multiple coiled coil motifs which is located in the nucleus, cytoplasm and mitochondria. The protein is involved in neurite outgrowth and cortical development through its interaction with other proteins.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors