DKC1 antibody (70R-5644)

Rabbit polyclonal DKC1 antibody raised against the N terminal of DKC1

Synonyms Polyclonal DKC1 antibody, Anti-DKC1 antibody, dyskerin antibody, NOLA4 antibody, Dyskeratosis Congenita 1 Dyskerin antibody, XAP101 antibody, DKC antibody, DKC-1, DKC 1, DKC 1 antibody, NAP57 antibody, DKC-1 antibody, DKC1
Specificity DKC1 antibody was raised against the N terminal of DKC1
Cross Reactivity Human
Applications WB
Immunogen DKC1 antibody was raised using the N terminal of DKC1 corresponding to a region with amino acids EFLIKPESKVAKLDTSQWPLLLKNFDKLNVRTTHYTPLACGSNPLKREIG
Assay Information DKC1 Blocking Peptide, catalog no. 33R-2407, is also available for use as a blocking control in assays to test for specificity of this DKC1 antibody


Western Blot analysis using DKC1 antibody (70R-5644)

DKC1 antibody (70R-5644) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 58 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DKC1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene is a member of the H/ACA snoRNPs (small nucleolar ribonucleoproteins) gene family. snoRNPs are involved in various aspects of rRNA processing and modification and have been classified into two families: C/D and H/ACA.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using DKC1 antibody (70R-5644) | DKC1 antibody (70R-5644) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors