DKFZP564O0523 antibody (70R-4970)

Rabbit polyclonal DKFZP564O0523 antibody raised against the C terminal of DKFZP564O0523

Synonyms Polyclonal DKFZP564O0523 antibody, Anti-DKFZP564O0523 antibody, Hypothetical Protein Dkfzp564O0523 antibody, DKFZp686D1651 antibody, HSPC304 antibody
Specificity DKFZP564O0523 antibody was raised against the C terminal of DKFZP564O0523
Cross Reactivity Human
Applications WB
Immunogen DKFZP564O0523 antibody was raised using the C terminal of DKFZP564O0523 corresponding to a region with amino acids FLQTNPTGNEIMIGPLLPDISKVDMHDDSLNTTANLIRHKLKEVISSVPK
Assay Information DKFZP564O0523 Blocking Peptide, catalog no. 33R-2980, is also available for use as a blocking control in assays to test for specificity of this DKFZP564O0523 antibody


Western Blot analysis using DKFZP564O0523 antibody (70R-4970)

DKFZP564O0523 antibody (70R-4970) used at 0.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DKFZP564O0523 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of DKFZP564O0523 has not been widely studied, and is yet to be fully elucidated.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using DKFZP564O0523 antibody (70R-4970) | DKFZP564O0523 antibody (70R-4970) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors