DKFZP761C169 Blocking Peptide (33R-7991)

A synthetic peptide for use as a blocking control in assays to test for specificity of DKFZP761C169 antibody, catalog no. 70R-2280

Synonyms DKFZP761C169 control peptide, DKFZP761C169 antibody Blocking Peptide, Anti-DKFZP761C169 Blocking Peptide,, DKFZP761C169, DKFZPC169-761, DKFZPC169 761, DKFZPC169-761 Blocking Peptide, DKFZPC169 761 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues RKEKNGWRTHGRNGTENINHRGGYHGGSSRSRSSIFHAGKSQGLHENNIP
Molecular Weight 52 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Vasculin is a novel vascular protein differentially expressed in human atherogenesis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors