DKFZP761C169 Blocking Peptide (33R-7991)
A synthetic peptide for use as a blocking control in assays to test for specificity of DKFZP761C169 antibody, catalog no. 70R-2280
Overview
Overview
| Synonyms | DKFZP761C169 control peptide, DKFZP761C169 antibody Blocking Peptide, Anti-DKFZP761C169 Blocking Peptide,, DKFZP761C169, DKFZPC169-761, DKFZPC169 761, DKFZPC169-761 Blocking Peptide, DKFZPC169 761 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | RKEKNGWRTHGRNGTENINHRGGYHGGSSRSRSSIFHAGKSQGLHENNIP |
|---|---|
| Molecular Weight | 52 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | Vasculin is a novel vascular protein differentially expressed in human atherogenesis. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product