DLC1 Blocking Peptide (33R-6752)
A synthetic peptide for use as a blocking control in assays to test for specificity of DLC1 antibody, catalog no. 70R-1946
Overview
Overview
| Synonyms | DLC1 control peptide, DLC1 antibody Blocking Peptide, Anti-DLC1 Blocking Peptide, Deleted In LiverCancer 1 Blocking Peptide, ARHGAP7 Blocking Peptide, FLJ21120 Blocking Peptide, HP Blocking Peptide, STARD12 Blocking Peptide, p122-RhoGAP Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | NLAVCLAPSLFHLNTLKRENSSPRVMQRKQSLGKPDQKDLNENLAATQGL |
|---|---|
| Molecular Weight | 52 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | This gene is deleted in the primary tumor of hepatocellular carcinoma. It maps to 8p22-p21.3, a region frequently deleted in solid tumors. It is suggested that this gene is a candidate tumor suppressor gene for human liver cancer, as well as for prostate, lung, colorectal, and breast cancers. DLC1 functions as a GTPase-activating protein specific for Rho and an activator of PLCD1 in vivo and induces morphological changes and detachment through cytoskeletal reorganization. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product