DLC1 Blocking Peptide (33R-6752)

A synthetic peptide for use as a blocking control in assays to test for specificity of DLC1 antibody, catalog no. 70R-1946

Synonyms DLC1 control peptide, DLC1 antibody Blocking Peptide, Anti-DLC1 Blocking Peptide, Deleted In LiverCancer 1 Blocking Peptide, ARHGAP7 Blocking Peptide, FLJ21120 Blocking Peptide, HP Blocking Peptide, STARD12 Blocking Peptide, p122-RhoGAP Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues NLAVCLAPSLFHLNTLKRENSSPRVMQRKQSLGKPDQKDLNENLAATQGL
Molecular Weight 52 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene is deleted in the primary tumor of hepatocellular carcinoma. It maps to 8p22-p21.3, a region frequently deleted in solid tumors. It is suggested that this gene is a candidate tumor suppressor gene for human liver cancer, as well as for prostate, lung, colorectal, and breast cancers. DLC1 functions as a GTPase-activating protein specific for Rho and an activator of PLCD1 in vivo and induces morphological changes and detachment through cytoskeletal reorganization.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors