DLG4 antibody (70R-4080)

Rabbit polyclonal DLG4 antibody

Synonyms Polyclonal DLG4 antibody, Anti-DLG4 antibody, PSD95 antibody, SAP90 antibody, Discs Large Homolog 4 antibody
Cross Reactivity Human
Applications WB
Immunogen DLG4 antibody was raised using a synthetic peptide corresponding to a region with amino acids AAHLHPIAIFIRPRSLENVLEINKRITEEQARKAFDRATKLEQEFTECFS
Assay Information DLG4 Blocking Peptide, catalog no. 33R-1027, is also available for use as a blocking control in assays to test for specificity of this DLG4 antibody


Western Blot analysis using DLG4 antibody (70R-4080)

DLG4 antibody (70R-4080) used at 0.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 85 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DLG4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a member of the membrane-associated guanylate kinase (MAGUK) family. It heteromultimerizes with another MAGUK protein, DLG2, and is recruited into NMDA receptor and potassium channel clusters. These two MAGUK proteins may interact at postsynaptic sites to form a multimeric scaffold for the clustering of receptors, ion channels, and associated signaling proteins. Multiple transcript variants encoding different isoforms have been found for this gene.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using DLG4 antibody (70R-4080) | DLG4 antibody (70R-4080) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors