DLG4 Blocking Peptide (33R-1027)

A synthetic peptide for use as a blocking control in assays to test for specificity of DLG4 antibody, catalog no. 70R-4080

Synonyms DLG4 control peptide, DLG4 antibody Blocking Peptide, Anti-DLG4 Blocking Peptide, Discs Large Homolog 4 Blocking Peptide, PSD95 Blocking Peptide, SAP90 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues AAHLHPIAIFIRPRSLENVLEINKRITEEQARKAFDRATKLEQEFTECFS
Molecular Weight 85 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a member of the membrane-associated guanylate kinase (MAGUK) family. It heteromultimerizes with another MAGUK protein, DLG2, and is recruited into NMDA receptor and potassium channel clusters. These two MAGUK proteins may interact at postsynaptic sites to form a multimeric scaffold for the clustering of receptors, ion channels, and associated signaling proteins. Multiple transcript variants encoding different isoforms have been found for this gene.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors