DLG7 antibody (70R-2401)

Rabbit polyclonal DLG7 antibody raised against the N terminal Of Dlg7

Synonyms Polyclonal DLG7 antibody, Anti-DLG7 antibody, KIAA0008 antibody, DLG1 antibody, HURP antibody
Specificity DLG7 antibody was raised against the N terminal Of Dlg7
Cross Reactivity Human,Mouse
Applications WB
Immunogen DLG7 antibody was raised using the N terminal Of Dlg7 corresponding to a region with amino acids EYERNRHFGLKDVNIPTLEGRILVELDETSQELVPEKTNVKPRAMKTILG
Assay Information DLG7 Blocking Peptide, catalog no. 33R-2820, is also available for use as a blocking control in assays to test for specificity of this DLG7 antibody

Images

Western Blot analysis using DLG7 antibody (70R-2401)

DLG7 antibody (70R-2401) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 95 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DLG7 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DLG7 is a potential cell cycle regulator that may play a role in carcinogenesis of cancer cells. It is a mitotic phosphoprotein regulated by the ubiquitin-proteasome pathway. DLG7 is the key regulator of adherens junction integrity and differentiation that may be involved in CDH1-mediated adhesion and signaling in epithelial cells.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using DLG7 antibody (70R-2401) | DLG7 antibody (70R-2401) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors