DLL3 Blocking Peptide (33R-6609)
A synthetic peptide for use as a blocking control in assays to test for specificity of DLL3 antibody, catalog no. 70R-7121
Overview
Overview
| Synonyms | DLL3 control peptide, DLL3 antibody Blocking Peptide, Anti-DLL3 Blocking Peptide, Delta-Like 3 Blocking Peptide, SCDO1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | MVSPRMSGLLSQTVILALIFLPQTRPAGVFELQIHSFGPGPGPGAPRSPC |
|---|---|
| Molecular Weight | 54 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | DLL3 is a member of the delta protein ligand family. This family functions as Notch ligands that are characterized by a DSL domain, EGF repeats, and a transmembrane domain. Mutations in this gene cause autosomal recessive spondylocostal dysostosis 1. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product