DLL3 Blocking Peptide (33R-6609)

A synthetic peptide for use as a blocking control in assays to test for specificity of DLL3 antibody, catalog no. 70R-7121

Synonyms DLL3 control peptide, DLL3 antibody Blocking Peptide, Anti-DLL3 Blocking Peptide, Delta-Like 3 Blocking Peptide, SCDO1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues MVSPRMSGLLSQTVILALIFLPQTRPAGVFELQIHSFGPGPGPGAPRSPC
Molecular Weight 54 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DLL3 is a member of the delta protein ligand family. This family functions as Notch ligands that are characterized by a DSL domain, EGF repeats, and a transmembrane domain. Mutations in this gene cause autosomal recessive spondylocostal dysostosis 1.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors