DMBT1 Blocking Peptide (33R-8945)

A synthetic peptide for use as a blocking control in assays to test for specificity of DMBT1 antibody, catalog no. 70R-3916

Synonyms DMBT1 control peptide, DMBT1 antibody Blocking Peptide, Anti-DMBT1 Blocking Peptide, Deleted In Malignant Brain Tumors 1 Blocking Peptide, GP340 Blocking Peptide, MGC164738 Blocking Peptide, muclin Blocking Peptide, DMBT1, DMBT-1, DMBT 1, DMBT-1 Blocking Peptide, DMBT 1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues SWSTPSPDTLPTITLPASTVGSESSLALRLVNGGDRCQGRVEVLYRGSWG
Molecular Weight 258 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Loss of sequences from human chromosome 10q has been associated with the progression of human cancers. The gene DMBT1 was originally isolated based on its deletion in a medulloblastoma cell line. DMBT1 is expressed with transcripts of 6.0, 7.5, and 8.0 kb in fetal lung and with one transcript of 8.0 kb in adult lung, although the 7.5 kb transcript has not been characterized. The DMBT1 protein is a glycoprotein containing multiple scavenger receptor cysteine-rich (SRCR) domains separated by SRCR-interspersed domains (SID). Transcript variant 2 (8.0 kb) has been shown to bind surfactant protein D independently of carbohydrate recognition. This indicates that DMBT1 may not be a classical tumor supressor gene, but rather play a role in the interaction of tumor cells and the immune system.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors