DNAJC1 Blocking Peptide (33R-7786)
A synthetic peptide for use as a blocking control in assays to test for specificity of DNAJC1 antibody, catalog no. 70R-7434
Overview
Overview
| Synonyms | DNAJC1 control peptide, DNAJC1 antibody Blocking Peptide, Anti-DNAJC1 Blocking Peptide, Dnaj Blocking Peptide, Hsp40 Homolog Subfamily C 1 Blocking Peptide, DNAJL1 Blocking Peptide, ERdj1 Blocking Peptide, HTJ1 Blocking Peptide, MGC131954 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | QWHDLLPCKLGIWFCLTLKALPHLIQDAGQFYAKYKETRLKEKEDALTRT |
|---|---|
| Molecular Weight | 64 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | DNAJC1 contains 1 J domain and 2 SANT domains. The exact function of DNAJC1 remains unknown. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product