DNAJC1 Blocking Peptide (33R-7786)

A synthetic peptide for use as a blocking control in assays to test for specificity of DNAJC1 antibody, catalog no. 70R-7434

Synonyms DNAJC1 control peptide, DNAJC1 antibody Blocking Peptide, Anti-DNAJC1 Blocking Peptide, Dnaj Blocking Peptide, Hsp40 Homolog Subfamily C 1 Blocking Peptide, DNAJL1 Blocking Peptide, ERdj1 Blocking Peptide, HTJ1 Blocking Peptide, MGC131954 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues QWHDLLPCKLGIWFCLTLKALPHLIQDAGQFYAKYKETRLKEKEDALTRT
Molecular Weight 64 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DNAJC1 contains 1 J domain and 2 SANT domains. The exact function of DNAJC1 remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors