DNALI1 Blocking Peptide (33R-6612)
A synthetic peptide for use as a blocking control in assays to test for specificity of DNALI1 antibody, catalog no. 70R-3315
Overview
Overview
| Synonyms | DNALI1 control peptide, DNALI1 antibody Blocking Peptide, Anti-DNALI1 Blocking Peptide, Dynein Axonemal Light Intermediate Chain 1 Blocking Peptide, P28 Blocking Peptide, dJ423B22.5 Blocking Peptide, hp28 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | MVTANKAHTGQGSCWVATLASAMIPPADSLLKYDTPVLVSRNTEKRSPKA |
|---|---|
| Molecular Weight | 31 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | DNALI1 is the human homolog of the Chlamydomonas inner dynein arm gene, p28. The precise function of this gene is not known, however, it is a potential candidate for immotile cilia syndrome (ICS). Ultrastructural defects of the inner dynein arms are seen in patients with ICS. Immotile mutant strains of Chlamydomonas, a biflagellated algae, exhibit similar defects. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product