DNALI1 Blocking Peptide (33R-6612)

A synthetic peptide for use as a blocking control in assays to test for specificity of DNALI1 antibody, catalog no. 70R-3315

Synonyms DNALI1 control peptide, DNALI1 antibody Blocking Peptide, Anti-DNALI1 Blocking Peptide, Dynein Axonemal Light Intermediate Chain 1 Blocking Peptide, P28 Blocking Peptide, dJ423B22.5 Blocking Peptide, hp28 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues MVTANKAHTGQGSCWVATLASAMIPPADSLLKYDTPVLVSRNTEKRSPKA
Molecular Weight 31 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DNALI1 is the human homolog of the Chlamydomonas inner dynein arm gene, p28. The precise function of this gene is not known, however, it is a potential candidate for immotile cilia syndrome (ICS). Ultrastructural defects of the inner dynein arms are seen in patients with ICS. Immotile mutant strains of Chlamydomonas, a biflagellated algae, exhibit similar defects.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors