DOLPP1 Blocking Peptide (33R-1013)
A synthetic peptide for use as a blocking control in assays to test for specificity of DOLPP1 antibody, catalog no. 70R-6895
Overview
Overview
| Synonyms | DOLPP1 control peptide, DOLPP1 antibody Blocking Peptide, Anti-DOLPP1 Blocking Peptide, Dolichyl Pyrophosphate Phosphatase 1 Blocking Peptide, LSFR2 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | AADGQCSLPASWRPVTLTHVEYPAGDLSGHLLAYLSLSPVFVIVGFVTLI |
|---|---|
| Molecular Weight | 27 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | DOLPP1 is a multi-pass membrane proteinBy similarity. It belongs to the dolichyldiphosphatase family. It is required for efficient N-glycosylation and is necessary for maintaining optimal levels of dolichol-linked oligosaccharides. DOLPP1 hydrolyzes dolichyl pyrophosphate at a very high rate and dolichyl monophosphate at a much lower rate. It does not act on phosphatidate. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product