DOLPP1 Blocking Peptide (33R-1013)

A synthetic peptide for use as a blocking control in assays to test for specificity of DOLPP1 antibody, catalog no. 70R-6895

Synonyms DOLPP1 control peptide, DOLPP1 antibody Blocking Peptide, Anti-DOLPP1 Blocking Peptide, Dolichyl Pyrophosphate Phosphatase 1 Blocking Peptide, LSFR2 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues AADGQCSLPASWRPVTLTHVEYPAGDLSGHLLAYLSLSPVFVIVGFVTLI
Molecular Weight 27 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DOLPP1 is a multi-pass membrane proteinBy similarity. It belongs to the dolichyldiphosphatase family. It is required for efficient N-glycosylation and is necessary for maintaining optimal levels of dolichol-linked oligosaccharides. DOLPP1 hydrolyzes dolichyl pyrophosphate at a very high rate and dolichyl monophosphate at a much lower rate. It does not act on phosphatidate.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors