DPH2 antibody (70R-3392)

Rabbit polyclonal DPH2 antibody

Synonyms Polyclonal DPH2 antibody, Anti-DPH2 antibody, Dph2 Homolog antibody, DPH2L2 antibody
Cross Reactivity Human
Applications WB
Immunogen DPH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids CLSPPARPLPVAFVLRQRSVALELCVKAFEAQNPDPKAPVVLLSEPACAH
Assay Information DPH2 Blocking Peptide, catalog no. 33R-1746, is also available for use as a blocking control in assays to test for specificity of this DPH2 antibody


Western Blot analysis using DPH2 antibody (70R-3392)

DPH2 antibody (70R-3392) used at 0.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 52 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DPH2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene is one of two human genes similar to the yeast gene dph2. The yeast gene was identified by its ability to complement a diphthamide mutant strain, and thus probably functions in diphthamide biosynthesis. Diphthamide is a post-translationally modified histidine residue present in elongation factor 2 (EF2) that is the target of diphtheria toxin ADP-ribosylation. This gene is one of two human genes similar to the yeast gene dph2.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using DPH2 antibody (70R-3392) | DPH2 antibody (70R-3392) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors