DPP6 Blocking Peptide (33R-1028)
A synthetic peptide for use as a blocking control in assays to test for specificity of DPP6 antibody, catalog no. 70R-6835
Overview
Overview
| Synonyms | DPP6 control peptide, DPP6 antibody Blocking Peptide, Anti-DPP6 Blocking Peptide, Dipeptidyl-Peptidase 6 Blocking Peptide, DPPX Blocking Peptide, MGC46605 Blocking Peptide, DPP6, DPP-6, DPP 6, DPP-6 Blocking Peptide, DPP 6 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | AAINDSRVPIMELPTYTGSIYPTVKPYHYPKAGSENPSISLHVIGLNGPT |
|---|---|
| Molecular Weight | 91 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | DPP6 is a single-pass type II membrane protein that is a member of the S9B family in clan SC of the serine proteases. This protein has no detectable protease activity, most likely due to the absence of the conserved serine residue normally present in the catalytic domain of serine proteases. However, it does bind specific voltage-gated potassium channels and alters their expression and biophysical properties. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product