DPPA4 antibody (70R-3293)

Rabbit polyclonal DPPA4 antibody raised against the N terminal of DPPA4

Synonyms Polyclonal DPPA4 antibody, Anti-DPPA4 antibody, Developmental Pluripotency Associated 4 antibody, 2410091M23Rik antibody, FLJ10713 antibody
Specificity DPPA4 antibody was raised against the N terminal of DPPA4
Cross Reactivity Human
Applications WB
Immunogen DPPA4 antibody was raised using the N terminal of DPPA4 corresponding to a region with amino acids MLRGSASSTSMEKAKGKEWTSTEKSREEDQQASNQPNSIALPGTSAKRTK
Assay Information DPPA4 Blocking Peptide, catalog no. 33R-6210, is also available for use as a blocking control in assays to test for specificity of this DPPA4 antibody


Western Blot analysis using DPPA4 antibody (70R-3293)

DPPA4 antibody (70R-3293) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DPPA4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DPPA4 may play a role in maintaining cell pluripotentiality.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using DPPA4 antibody (70R-3293) | DPPA4 antibody (70R-3293) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors