DPPA4 Blocking Peptide (33R-6210)
A synthetic peptide for use as a blocking control in assays to test for specificity of DPPA4 antibody, catalog no. 70R-3293
Overview
Overview
| Synonyms | DPPA4 control peptide, DPPA4 antibody Blocking Peptide, Anti-DPPA4 Blocking Peptide, Developmental Pluripotency Associated 4 Blocking Peptide, 2410091M23Rik Blocking Peptide, FLJ10713 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | MLRGSASSTSMEKAKGKEWTSTEKSREEDQQASNQPNSIALPGTSAKRTK |
|---|---|
| Molecular Weight | 33 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | DPPA4 may play a role in maintaining cell pluripotentiality. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product