DRB1 antibody (70R-1352)

Rabbit polyclonal DRB1 antibody raised against the N terminal of DRB1

Synonyms Polyclonal DRB1 antibody, Anti-DRB1 antibody, Developmentally Regulated Rna-Binding Protein 1 antibody
Specificity DRB1 antibody was raised against the N terminal of DRB1
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen DRB1 antibody was raised using the N terminal of DRB1 corresponding to a region with amino acids MDEAGSSASGGGFRPGVDSLDEPPNSRIFLVISKYTPESVLRERFSPFGD
Assay Information DRB1 Blocking Peptide, catalog no. 33R-5829, is also available for use as a blocking control in assays to test for specificity of this DRB1 antibody


Western Blot analysis using DRB1 antibody (70R-1352)

DRB1 antibody (70R-1352) used at 1.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of DRB1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DRB1 is RNA-binding protein with binding specificity for poly(C) and may play an important role in neural development.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using DRB1 antibody (70R-1352) | DRB1 antibody (70R-1352) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: €227.26
Size: 100 ug
View Our Distributors