DRGX Blocking Peptide (33R-6592)

A synthetic peptide for use as a blocking control in assays to test for specificity of DRGX antibody, catalog no. 70R-8703

Synonyms DRGX control peptide, DRGX antibody Blocking Peptide, Anti-DRGX Blocking Peptide, dorsal root ganglia homeobox Blocking Peptide, DRG11 Blocking Peptide, PRRXL1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues MVLMSCDQRLISLLLVGTATFGNHSSGDFDDGFLRRKQRRNRTTFTLQQL
Molecular Weight 29 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DRGX is a transcription factor required for the formation of correct projections from nociceptive sensory neurons to the dorsal horn of the spinal cord and normal perception of pain.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors