DRGX Blocking Peptide (33R-6592)
A synthetic peptide for use as a blocking control in assays to test for specificity of DRGX antibody, catalog no. 70R-8703
Overview
Overview
| Synonyms | DRGX control peptide, DRGX antibody Blocking Peptide, Anti-DRGX Blocking Peptide, dorsal root ganglia homeobox Blocking Peptide, DRG11 Blocking Peptide, PRRXL1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | MVLMSCDQRLISLLLVGTATFGNHSSGDFDDGFLRRKQRRNRTTFTLQQL |
|---|---|
| Molecular Weight | 29 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | DRGX is a transcription factor required for the formation of correct projections from nociceptive sensory neurons to the dorsal horn of the spinal cord and normal perception of pain. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product