DSCAM Blocking Peptide (33R-6387)
A synthetic peptide for use as a blocking control in assays to test for specificity of DSCAM antibody, catalog no. 70R-6114
Overview
Overview
| Synonyms | DSCAM control peptide, DSCAM antibody Blocking Peptide, Anti-DSCAM Blocking Peptide, Down Syndrome Cell Adhesion Molecule Blocking Peptide, CHD2-42 Blocking Peptide, CHD2-52 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | MRVCNSAGCAEKQANFATLNYDGSTIPPLIKSVVQNEEGLTTNEGLKMLV |
|---|---|
| Molecular Weight | 220 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | DSCAM is a cell adhesion molecule that can mediate cation-independent homophilic binding activity. DSCAM could be involved in nervous system development. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product