DTX2 antibody (70R-2228)

Rabbit polyclonal DTX2 antibody

Synonyms Polyclonal DTX2 antibody, Anti-DTX2 antibody, MGC71098 antibody, RNF58 antibody, DTX 2, DTX-2 antibody, Deltex Homolog 2 antibody, DTX-2, DTX2, DTX 2 antibody, KIAA1528 antibody
Cross Reactivity Human,Dog,ZebraFish
Applications WB
Immunogen DTX2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EDCGTILIVYSIPHGIQGPEHPNPGKPFTARGFPRQCYLPDNAQGRKVLE
Assay Information DTX2 Blocking Peptide, catalog no. 33R-2305, is also available for use as a blocking control in assays to test for specificity of this DTX2 antibody


Western Blot analysis using DTX2 antibody (70R-2228)

DTX2 antibody (70R-2228) used at 0.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 62 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DTX2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DTX2 is a regulator of Notch signaling, a signaling pathway involved in cell-cell communications that regulates a broad spectrum of cell-fate determinations. DTX2 probably acts both as a positive and negative regulator of Notch, depending on the developmental and cell context and mediates the antineural activity of Notch, possibly by inhibiting the transcriptional activation mediated by MATCH1. It also functions as an ubiquitin ligase protein in vitro, suggesting that it may regulate the Notch pathway via some ubiquitin ligase activity.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using DTX2 antibody (70R-2228) | DTX2 antibody (70R-2228) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors