DUOXA1 Blocking Peptide (33R-10375)

A synthetic peptide for use as a blocking control in assays to test for specificity of DUOXA1 antibody, catalog no. 70R-10265

Synonyms DUOXA1 control peptide, DUOXA1 antibody Blocking Peptide, Anti-DUOXA1 Blocking Peptide, dual oxidase maturation factor 1 Blocking Peptide, FLJ32334 Blocking Peptide, NIP Blocking Peptide, NUMBIP Blocking Peptide, mol Blocking Peptide, DUOXA1, DUOXA-1, DUOXA 1, DUOXA-1 Blocking Peptide, DUOXA 1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues PEEGGLLSPRYRSMADSPKSQDIPLSEASSTKAYYRPRRLSLVPADVRGL
Molecular Weight 53 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of this protein remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €122.31
Size: 100 ug
OR
Shipping
View Our Distributors