DUSP19 antibody (70R-4137)

Rabbit polyclonal DUSP19 antibody raised against the C terminal of DUSP19

Synonyms Polyclonal DUSP19 antibody, Anti-DUSP19 antibody, DUSP 19 antibody, MGC138210 antibody, Dual Specificity Phosphatase 19 antibody, SKRP1 antibody, TS-DSP1 antibody, DUSP17 antibody, DUSP-19, DUSP-19 antibody, DUSP19, DUSP 19
Specificity DUSP19 antibody was raised against the C terminal of DUSP19
Cross Reactivity Human
Applications WB
Immunogen DUSP19 antibody was raised using the C terminal of DUSP19 corresponding to a region with amino acids SEQTSFTSAFSLVKNARPSICPNSGFMEQLRTYQEGKESNKCDRIQENSS
Assay Information DUSP19 Blocking Peptide, catalog no. 33R-8399, is also available for use as a blocking control in assays to test for specificity of this DUSP19 antibody

Images

Western Blot analysis using DUSP19 antibody (70R-4137)

DUSP19 antibody (70R-4137) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 24 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DUSP19 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DUSP19 belongs to the protein-tyrosine phosphatase family, non-receptor class dual specificity subfamily. It contains 1 tyrosine-protein phosphatase domain. DUSP19 has a dual specificity toward Ser/Thr and Tyr-containing proteins.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using DUSP19 antibody (70R-4137) | DUSP19 antibody (70R-4137) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors