Dusp19 Blocking Peptide (33R-10365)

A synthetic peptide for use as a blocking control in assays to test for specificity of Dusp19 antibody, catalog no. 70R-9185

Synonyms Dusp19 control peptide, Dusp19 antibody Blocking Peptide, Anti-Dusp19 Blocking Peptide, dual specificity phosphatase 19 Blocking Peptide, Dusp19, Dusp-19, Dusp 19, Dusp-19 Blocking Peptide, Dusp 19 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues MHSLNQEIKAFSRDNLRKQCTRVTTLTGKKLIETWKDATVHVVETETSGG
Molecular Weight 24 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Dusp19 has a dual specificity toward Ser/Thr and Tyr-containing proteins.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €122.31
Size: 100 ug
OR
Shipping
View Our Distributors