DUT antibody (70R-2132)

Rabbit polyclonal DUT antibody raised against the N terminal of DUT

Synonyms Polyclonal DUT antibody, Anti-DUT antibody, FLJ20622 antibody, Deoxyuridine Triphosphatase antibody, dUTPase antibody
Specificity DUT antibody was raised against the N terminal of DUT
Cross Reactivity Human
Applications WB
Immunogen DUT antibody was raised using the N terminal of DUT corresponding to a region with amino acids AAVLSGPGPPLGRAAQHGIPRPLSSAGRLSQGCRGASTVGAAGWKGELPK
Assay Information DUT Blocking Peptide, catalog no. 33R-1060, is also available for use as a blocking control in assays to test for specificity of this DUT antibody


Immunohistochemical staining using DUT antibody (70R-2132)

DUT antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 19 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DUT antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DUT is an essential enzyme of nucleotide metabolism. This protein forms a ubiquitous, homotetrameric enzyme that hydrolyzes dUTP to dUMP and pyrophosphate. This reaction serves two cellular purposes: providing a precursor (dUMP) for the synthesis of thymine nucleotides needed for DNA replication, and limiting intracellular pools of dUTP. Elevated levels of dUTP lead to increased incorporation of uracil into DNA, which induces extensive excision repair mediated by uracil glycosylase. This repair process, resulting in the removal and reincorporation of dUTP, is self-defeating and leads to DNA fragmentation and cell death.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using DUT antibody (70R-2132) | DUT antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using DUT antibody (70R-2132) | DUT antibody (70R-2132) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
View Our Distributors