DUT Blocking Peptide (33R-1060)
A synthetic peptide for use as a blocking control in assays to test for specificity of DUT antibody, catalog no. 70R-2132
Overview
Overview
| Synonyms | DUT control peptide, DUT antibody Blocking Peptide, Anti-DUT Blocking Peptide, Deoxyuridine Triphosphatase Blocking Peptide, FLJ20622 Blocking Peptide, dUTPase Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | AAVLSGPGPPLGRAAQHGIPRPLSSAGRLSQGCRGASTVGAAGWKGELPK |
|---|---|
| Molecular Weight | 19 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | DUT is an essential enzyme of nucleotide metabolism. This protein forms a ubiquitous, homotetrameric enzyme that hydrolyzes dUTP to dUMP and pyrophosphate. This reaction serves two cellular purposes: providing a precursor (dUMP) for the synthesis of thymine nucleotides needed for DNA replication, and limiting intracellular pools of dUTP. Elevated levels of dUTP lead to increased incorporation of uracil into DNA, which induces extensive excision repair mediated by uracil glycosylase. This repair process, resulting in the removal and reincorporation of dUTP, is self-defeating and leads to DNA fragmentation and cell death. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product