DUX3 Blocking Peptide (33R-10374)

A synthetic peptide for use as a blocking control in assays to test for specificity of DUX3 antibody, catalog no. 70R-8087

Synonyms DUX3 control peptide, DUX3 antibody Blocking Peptide, Anti-DUX3 Blocking Peptide, double homeobox 3 Blocking Peptide, DUX3, DUX-3, DUX 3, DUX-3 Blocking Peptide, DUX 3 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues PCPSVKFRPGLPAMALLTALDDTLPEEAQGPGRRMILLSTPSQSDALRAC
Molecular Weight 19 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The human genome contains hundreds of repeats of the 3.3-kb family in regions associated with heterochromatin. The DUX gene family, including DUX3, resides within these 3.3-kb repeated elements.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €122.31
Size: 100 ug
OR
Shipping
View Our Distributors